PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC718_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 799aa    MW: 89128.6 Da    PI: 6.6559
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC718_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.61.5e-4275152178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqve+Ceadls++k+yhrrhkvCe+hska+++lv g++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  RrC718_p6  75 VCQVENCEADLSKVKDYHRRHKVCEMHSKATSALVGGIMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKTNP 152
                6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3469137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.58273150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-3975154IPR004333Transcription factor, SBP-box
PfamPF031104.4E-3176149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MEARIEGEGQ HFYGYRAMDV RSVGKRSVEW DLNDWKWDGD LFVATPLNPG ASRNSAAAKK  60
TKFGGGGGGV ANRSVCQVEN CEADLSKVKD YHRRHKVCEM HSKATSALVG GIMQRFCQQC  120
SRFHVLEEFD EGKRSCRRRL AGHNKRRRKT NPEPGANGNP LSDDHQSSNL LLITLLKILS  180
NMHSSGSDHP GDQDLMPHLL KSLVSHAGEQ LGKNLVELLL QGGGSQASGL LAVEQAPQED  240
LKQAPQLPRQ ELYANGTASG NRSEKQARVN DFDLNDIYID SDDGTDIERS SPPPTNPATS  300
SPDYPSWIHQ TSPPQTTRNS DSASDQSPSS SSEDAQMRTG RIVFKLFGKE PNDFPVVLRG  360
QILDWLSHTP TDIESYIRPG CIVLTIYLRQ AETAWDELSD DMGFSLSKLL DLSDDPLWTT  420
GWIYVRVQNQ YAFVSDGQVV VDTSLPLRSR DYSHITSVRP LAVAATGKAQ FTVKGINLRR  480
PGTRLLCAVE GKYLTQETTK ENDDLKESND IVECVNFSCD LPITSGRGFM EIEDQGLSSS  540
FFPFIVVEED DVCSEIRVLE TTLEFTGTDS AKQAMEFIHE LGWLLQRSKL GVFPLTRFKW  600
LIEFSMDREW CAVIRKLLNM FFEGAVGDYS SSSPSDAALS ELCLLHRAVR KNSKPMVGIG  660
AWRTSRDSTG FTPEDYARLR GHFSYIHLIQ RKINKKSATE DHVVVNIPAS ISDREQKETK  720
PGSSALEITH GNHKLQCKLC DHKLVYGTGR RSVAYRPAML SMVAIAAVCV CVALLFKSCP  780
EVLYVFQPFR WELLDYGTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3266149184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8159480.0KC815948.1 Arabis alpina SQUAMOSA promoter binding protein-like protein 1 (SPL1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397898.10.0hypothetical protein EUTSA_v10001295mg
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLV4N2D60.0V4N2D6_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__2943__AT2G47070.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1